Converting ChEMBL to sequence

This page gives you access to a subset of ChEMBL that has been converted to Protein Line Notation. A total of 27142 structures out of 39123 "peptide-like" structures have been successfully converted. More details on the conversion process can be found beneath the structure table.


ChEMBL ID contains
Search is done within records with converted sequences only. Result listing is limited to max. 100 records.
Refresh page with an empty search box to get 100 random structures.

20 randomly selected converted structures

ChEMBL IDChEMBL structureConverted sequence imageProteax PLN (Protein Line Notation)
CHEMBL275075H-RPK{d}PQQFFG{d}LM-[NH2] name=CHEMBL275075
CHEMBL1793988(cyclo)-[Res_78][Aodo][Res_1765]I-(cyclo) name=CHEMBL1793988
CHEMBL574631[NTerm_820]-[Res_678]SKL-[CTerm_442] name=CHEMBL574631
CHEMBL2371830H-[PyGlu][Res_1402]P-[NH2] name=CHEMBL2371830
CHEMBL2370416[NTerm_700]-{d}[Res_742]PR-[Unknown_terminal_1] name=CHEMBL2370416 inline-mod=C-terminal,[Unknown_terminal_1],H1,QkNGTRECAS9TGwD7/p4ArwgdAPv+ngEAARhSAgABGg==
CHEMBL1688634H-RRRRRRRRKLSSIESDV-OH name=CHEMBL1688634
CHEMBL384005H-{d}F{d}C(1){d}YW{d}KVC(1)[Res_1340]-OH name=CHEMBL384005
CHEMBL2440185[acetyl]-RHYINLITRQRY-[NH2] name=CHEMBL2440185
CHEMBL454510[NTerm_410]-SWGC[Tyr(3-NO2)]-[NH2] name=CHEMBL454510
CHEMBL538261H-[Res_78][Res_2558]R-[Unknown_terminal_1] name=CHEMBL538261 inline-mod=C-terminal,[Unknown_terminal_1],H1,QkNGTRECAX8oAwC9/lUA/90EAL3+VQEAARhSAgABGg==
CHEMBL156642[NTerm_700]-W[Res_2433]DF-[CTerm_450] name=CHEMBL156642
CHEMBL1773554H-ISE[Res_2944]NLDAEFRH-[NH2] name=CHEMBL1773554
CHEMBL301825[NTerm_1156]-VPV-[CTerm_707] name=CHEMBL301825
CHEMBL2448563(cyclo)-[N(Me)Trp(OMe)][Leu(4R-5-Pr)][Res_1700]{d}[Res_774][Leu(4R-5-Pr)][MeLeu]L-(cyclo) name=CHEMBL2448563
CHEMBL583509(cyclo)-L{d}V[Res_733]FLL{d}V[Res_733]FL-(cyclo) name=CHEMBL583509
CHEMBL607208(cyclo)-[Res_621]SG[Res_2310][Res_2284][Res_1670]-(cyclo) name=CHEMBL607208
CHEMBL409823H-SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDAA-[NH2] name=CHEMBL409823
CHEMBL434186[NTerm_672]-[Res_2601]{d}FRWG-[NH2] name=CHEMBL434186
CHEMBL438389H-Y{d}AGFPLW-[CTerm_414] name=CHEMBL438389
CHEMBL492273H-E[Res_678]DV-OH name=CHEMBL492273

Conversion process

All structures in the ChEMBL 19 database were downloaded as an SD file and, with the help of KNIME, probable "peptide-like" structures were identified. The "peptide-like" structures were defined as those containing a substructure of three connected glysines. This yielded a "peptide-like" subset of 39123 structures.

The peptide subset was loaded into a PostgreSQL database table and the Biochemfusion Proteax cartridge was used to convert structures, when possible, to sequences. The first conversion took 87 seconds and produced 27142 converted sequences.

You can download the full set of produced sequences (TAB-separated file with ChEMBL ID + PLN, ~11MB).

All found unknown residues and terminal structures were embedded as inline structures in the first round of produced PLN. The embedded structures were then de-duplicated and extracted. You can download the structure sets in gzip-ed SD file format from here:

143 of the unknown residue structures have been assigned well-defined names by NextMove Software's great Sugar & Splice tool (press the "Biologics" button). Many thanks to Roger Sayle at NextMove Software for processing this subset of residues with Sugar & Splice.

NextMove's residue names can be applied to a Proteax modification database (where the above SD files have been imported) by the following SQL script:

The currently produced PLN has been generated after all the above data has been loaded into Proteax's database of known structures. As you will see, most of the non-natural residues and terminals have auto-generated names based on sequential numbers.