Converting ChEMBL to sequence

This page gives you access to a subset of ChEMBL that has been converted to Protein Line Notation. A total of 27142 structures out of 39123 "peptide-like" structures have been successfully converted. More details on the conversion process can be found beneath the structure table.



ChEMBL ID contains
Search is done within records with converted sequences only. Result listing is limited to max. 100 records.
Refresh page with an empty search box to get 100 random structures.

20 randomly selected converted structures

ChEMBL IDChEMBL structureConverted sequence imageProteax PLN (Protein Line Notation)
CHEMBL191472H-AFL-OH name=CHEMBL191472
CHEMBL2371025H-Y{d}[Res_895]F{d}[Res_1524]-[NH2] name=CHEMBL2371025
CHEMBL530345H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH name=CHEMBL530345
CHEMBL1169536H-{d}R{d}C(1){d}[Res_1036]GG{d}RI{d}DRI[Res_895]{d}R{d}C(1)-[NH2] name=CHEMBL1169536
CHEMBL165759[NTerm_820]-VPV-[CTerm_1220] name=CHEMBL165759
CHEMBL2103867H-NDEC(1)ELC(2)VNVAC(1)TGC(2)L-OH name=CHEMBL2103867
CHEMBL365385[NTerm_293]-[Res_1788]FRW-[NH2] name=CHEMBL365385
CHEMBL493105H-ESNV-OH name=CHEMBL493105
CHEMBL525957H-HSDGI[Res_2019]TDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-[NH2] name=CHEMBL525957
CHEMBL292761H-R{d}Y{d}L{d}P{d}[Res_872]-OH name=CHEMBL292761
CHEMBL2221069(cyclo)-{d}[Res_1276]R[Res_1340]G{d}Y-(cyclo) name=CHEMBL2221069
CHEMBL1929017[acetyl]-SAVLH-[Unknown_terminal_1] name=CHEMBL1929017 inline-mod=C-terminal,[Unknown_terminal_1],H1,QkNGTRECAR9hMQBg/QsAnxYzAGD9CwEAARhSAgABGg==
CHEMBL506650H-TPQRARRRKKRH-OH name=CHEMBL506650
CHEMBL1332005H-[Res_1700]IP-[CTerm_994] name=CHEMBL1332005
CHEMBL427784H-TTWEAWDRAIAEYAARIEALIRALQEQQQKNEAALREL-OH name=CHEMBL427784
CHEMBL316400(cyclo)-{d}P{d}HL{d}DT{d}D-(cyclo) name=CHEMBL316400
CHEMBL438886H-R{d}P{d}KPQQ{d}F{d}FGLM-[NH2] name=CHEMBL438886
CHEMBL2049018[NTerm_923]-RVR-[CTerm_1240] name=CHEMBL2049018
CHEMBL1790861[NTerm_1040]-GFTGARKSARK-OH name=CHEMBL1790861
CHEMBL1797526[NTerm_820]-FF[Res_141]-[CTerm_906] name=CHEMBL1797526

Conversion process

All structures in the ChEMBL 19 database were downloaded as an SD file and, with the help of KNIME, probable "peptide-like" structures were identified. The "peptide-like" structures were defined as those containing a substructure of three connected glysines. This yielded a "peptide-like" subset of 39123 structures.

The peptide subset was loaded into a PostgreSQL database table and the Biochemfusion Proteax cartridge was used to convert structures, when possible, to sequences. The first conversion took 87 seconds and produced 27142 converted sequences.

You can download the full set of produced sequences (TAB-separated file with ChEMBL ID + PLN, ~11MB).

All found unknown residues and terminal structures were embedded as inline structures in the first round of produced PLN. The embedded structures were then de-duplicated and extracted. You can download the structure sets in gzip-ed SD file format from here:

143 of the unknown residue structures have been assigned well-defined names by NextMove Software's great Sugar & Splice tool (press the "Biologics" button). Many thanks to Roger Sayle at NextMove Software for processing this subset of residues with Sugar & Splice.

NextMove's residue names can be applied to a Proteax modification database (where the above SD files have been imported) by the following SQL script:

The currently produced PLN has been generated after all the above data has been loaded into Proteax's database of known structures. As you will see, most of the non-natural residues and terminals have auto-generated names based on sequential numbers.