Converting ChEMBL to sequence

This page gives you access to a subset of ChEMBL that has been converted to Protein Line Notation. A total of 27142 structures out of 39123 "peptide-like" structures have been successfully converted. More details on the conversion process can be found beneath the structure table.



ChEMBL ID contains
Search is done within records with converted sequences only. Result listing is limited to max. 100 records.
Refresh page with an empty search box to get 100 random structures.

20 randomly selected converted structures

ChEMBL IDChEMBL structureConverted sequence imageProteax PLN (Protein Line Notation)
CHEMBL337200H-YGGFMH-[NH2] name=CHEMBL337200
CHEMBL438041H-MRILGEEKPNVDGVSTSNTPY-OH name=CHEMBL438041
CHEMBL437599H-[PyGlu]LQPF[Res_2748]QPELPYPQ-OH name=CHEMBL437599
CHEMBL414960H-FC(1)DGFYAC(1)YMDVK-[NH2] name=CHEMBL414960
CHEMBL499665H-HSD[Res_594]IFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-[NH2] name=CHEMBL499665
CHEMBL454266[NTerm_504]-G[PhTyr]QGLS-[NH2] name=CHEMBL454266
CHEMBL2071604(cyclo)-RGD{d}F[Res_1942]-(cyclo) name=CHEMBL2071604
CHEMBL1078514H-GC(1)EGKPC(2)GLFRSC(3)GGGC(1)RC(2)WPTVTPGVGIC(3)SSS-OH name=CHEMBL1078514
CHEMBL1076396H-[PyGlu]GVC(1)C(2)GQKLC(2)H[Res_2532]C(1)-OH name=CHEMBL1076396
CHEMBL111648[NTerm_140]-PRP-OH name=CHEMBL111648
CHEMBL1802438H-GGF{d}SFRF-[NH2] name=CHEMBL1802438
CHEMBL428836[NTerm_820]-H{d}[Res_2713][Res_488]{d}WA-[NH2] name=CHEMBL428836
CHEMBL339320H-Y[Res_3018](1)GFC(1)F-OH name=CHEMBL339320
CHEMBL405999H-C(1){d}N[Nle]{d}LH{d}QV{d}PC(1)N-OH name=CHEMBL405999
CHEMBL2440324[NTerm_759]-R[Nle][Nle]-[NH2] name=CHEMBL2440324
CHEMBL339956[NTerm_68]-{d}F[Res_2201]R-[CTerm_1150] name=CHEMBL339956
CHEMBL301442H-[Res_1611]C(1){d}V-OH.H-[Res_1611]C(1){d}V-OH name=CHEMBL301442
CHEMBL442297[NTerm_637]-GG[Res_2708]TGARKSARKRKN[Res_194]-[CTerm_204] name=CHEMBL442297
CHEMBL2372345H-DA[Res_1053]-[CTerm_810] name=CHEMBL2372345
CHEMBL1076961H-AELAALEAELAALEGWLIELLWIVGKLAALKAKLAALKA-OH name=CHEMBL1076961

Conversion process

All structures in the ChEMBL 19 database were downloaded as an SD file and, with the help of KNIME, probable "peptide-like" structures were identified. The "peptide-like" structures were defined as those containing a substructure of three connected glysines. This yielded a "peptide-like" subset of 39123 structures.

The peptide subset was loaded into a PostgreSQL database table and the Biochemfusion Proteax cartridge was used to convert structures, when possible, to sequences. The first conversion took 87 seconds and produced 27142 converted sequences.

You can download the full set of produced sequences (TAB-separated file with ChEMBL ID + PLN, ~11MB).

All found unknown residues and terminal structures were embedded as inline structures in the first round of produced PLN. The embedded structures were then de-duplicated and extracted. You can download the structure sets in gzip-ed SD file format from here:

143 of the unknown residue structures have been assigned well-defined names by NextMove Software's great Sugar & Splice tool (press the "Biologics" button). Many thanks to Roger Sayle at NextMove Software for processing this subset of residues with Sugar & Splice.

NextMove's residue names can be applied to a Proteax modification database (where the above SD files have been imported) by the following SQL script:

The currently produced PLN has been generated after all the above data has been loaded into Proteax's database of known structures. As you will see, most of the non-natural residues and terminals have auto-generated names based on sequential numbers.