Converting ChEMBL to sequence

This page gives you access to a subset of ChEMBL that has been converted to Protein Line Notation. A total of 27142 structures out of 39123 "peptide-like" structures have been successfully converted. More details on the conversion process can be found beneath the structure table.

ChEMBL ID contains

Search is done within records with converted sequences only. Result listing is limited to max. 100 records.

Refresh page with an empty search box to get 100 random structures.

20 randomly selected converted structures

ChEMBL ID	ChEMBL structure	Converted sequence image	Proteax PLN (Protein Line Notation)
CHEMBL1688620			[NTerm_937]-ETAV-OH name=CHEMBL1688620
CHEMBL1791343			H-GKPRPFSPRPTSHPRPIRV-[Unknown_terminal_1] name=CHEMBL1791343 inline-mod=C-terminal,[Unknown_terminal_1],H1,QkNGTRECAZ9pKQCn/3UAHx8rAKf/dQEAARhSAgABGg==
CHEMBL413455			H-INPC(1)YRL-[CTerm_311].H-INP{d}C(1)YRL-[CTerm_311] name=CHEMBL413455
CHEMBL405163			[NTerm_1030]-GDFE[Res_2775]IPEE[Res_2103]L{d}E-OH name=CHEMBL405163
CHEMBL2370304			H-{d}C(1){d}FFWK{d}TFC(1)-[NH2] name=CHEMBL2370304
CHEMBL120371			H-YPF-[CTerm_1213] name=CHEMBL120371
CHEMBL404932			H-RKKYKWRRK-[NH2] name=CHEMBL404932
CHEMBL1824979			[NTerm_522]-QLDL{d}[Res_1092]-OH name=CHEMBL1824979
CHEMBL41251			[NTerm_887]-LDT-[NH2] name=CHEMBL41251
CHEMBL544567			[NTerm_1314]-VFM-OH name=CHEMBL544567
CHEMBL357788			[NTerm_700]-[aMePro]FF-[CTerm_106] name=CHEMBL357788
CHEMBL528551			H-WEEWDKKIEEYTKKIEELIKKSEEQQKKNEEELKK-OH name=CHEMBL528551
CHEMBL1688831			H-MAIGPYPACGSG-OH name=CHEMBL1688831
CHEMBL68311			[NTerm_1620]-VPV-[CTerm_161] name=CHEMBL68311
CHEMBL262756			[NTerm_1688]-HWAVAH-[CTerm_136] name=CHEMBL262756
CHEMBL437641			H-FC(1)GDGFYAC(1)YMDV-OH name=CHEMBL437641
CHEMBL441206			H-RPKPQQFF[Res_315]{d}LW-[NH2] name=CHEMBL441206
CHEMBL367139			H-[Res_671]VL-[CTerm_751] name=CHEMBL367139
CHEMBL2370767			[acetyl]-ANKASYQSSSL-[CTerm_842] name=CHEMBL2370767
CHEMBL429719			H-[PyGlu]GPPISIDLPAYLLRKMIEIEKQEKEKQQAANNRLLLDTI-OH name=CHEMBL429719

Conversion process

All structures in the ChEMBL 19 database were downloaded as an SD file and, with the help of KNIME, probable "peptide-like" structures were identified. The "peptide-like" structures were defined as those containing a substructure of three connected glysines. This yielded a "peptide-like" subset of 39123 structures.

The peptide subset was loaded into a PostgreSQL database table and the Biochemfusion Proteax cartridge was used to convert structures, when possible, to sequences. The first conversion took 87 seconds and produced 27142 converted sequences.

You can download the full set of produced sequences (TAB-separated file with ChEMBL ID + PLN, ~11MB).

All found unknown residues and terminal structures were embedded as inline structures in the first round of produced PLN. The embedded structures were then de-duplicated and extracted. You can download the structure sets in gzip-ed SD file format from here:

N-terminals, 1699 structures, 420 kB
C-terminals, 1270 structures, 333 kB
Residues, 3030 structures, 726 kB

143 of the unknown residue structures have been assigned well-defined names by NextMove Software's great Sugar & Splice tool (press the "Biologics" button). Many thanks to Roger Sayle at NextMove Software for processing this subset of residues with Sugar & Splice.

NextMove's residue names can be applied to a Proteax modification database (where the above SD files have been imported) by the following SQL script:

Residue names update script, 143 name assigments, 18 kB

The currently produced PLN has been generated after all the above data has been loaded into Proteax's database of known structures. As you will see, most of the non-natural residues and terminals have auto-generated names based on sequential numbers.